DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E2f1 and DEL2

DIOPT Version :10

Sequence 1:NP_001262809.1 Gene:E2f1 / 42550 FlyBaseID:FBgn0011766 Length:821 Species:Drosophila melanogaster
Sequence 2:NP_197000.1 Gene:DEL2 / 831348 AraportID:AT5G14960 Length:359 Species:Arabidopsis thaliana


Alignment Length:194 Identity:44/194 - (22%)
Similarity:81/194 - (41%) Gaps:49/194 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 NRADTSLGILTKKFVDLLQESPDGVVDLNEASNRLHVQKRRIYDITNVLEGINILEKKSKNNIQW 317
            :|.|.|||:|...|:.|.......:..|::|:.:|.|::|||||:.|:||.|.::.:..||...|
plant    12 SRKDKSLGVLVANFLTLYNRPDVDLFGLDDAAAKLGVERRRIYDVVNILESIGLVARSGKNQYSW 76

  Fly   318 RCGQSMVSQERSRHIEADSLRLEQQENELNKAIDLMRENLAEISQE--VENSGGMAYVTQNDLLN 380
                                          |....:...|:|:.:|  .|....:.:|.::::  
plant    77 ------------------------------KGFGAVPRALSELKEEGMKEKFAIVPFVAKSEM-- 109

  Fly   381 VDLFKDQIVIVIKAPPEAKLVRSATALKFQPLPFNLNLPNTKLPREIYVKAENSGEINVFLCHD 444
                     :|.:...|...:.|....:|.|.|    .|:.:..|.:::.|:|.  :.:|||.|
plant   110 ---------VVYEKEGEESFMLSPDDQEFSPSP----RPDNRKERTLWLLAQNF--VKLFLCSD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E2f1NP_001262809.1 E2F_TDP 256..318 CDD:460530 22/61 (36%)
E2F_DD 327..444 CDD:473951 19/118 (16%)
coiled coil 327..362 CDD:271137 3/34 (9%)
DEL2NP_197000.1 E2F_TDP 14..78 CDD:460530 23/93 (25%)
E2F_TDP 139..217 CDD:460530 7/22 (32%)

Return to query results.
Submit another query.