DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Scr

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:441 Identity:100/441 - (22%)
Similarity:144/441 - (32%) Gaps:183/441 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRE---RSISKSPPLCCRDLGLYKL 78
            |:||.:|   .|:.||           |..|   ||.|||..|   ||::|..      ||    
  Fly   201 SQSLASP---QDLSTR-----------DISP---KLSPSSVVESVARSLNKGV------LG---- 238

  Fly    79 TQPKEIQPSARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRC 143
                          ..|...|||...|| :|..:|.|...             ..:..|:.....
  Fly   239 --------------GSLAAAAAAAGLNN-NHSGSGVSGGP-------------GNVNVPMHSPGG 275

  Fly   144 TSNDSDCDSPPPLSSSPSESPLSHDGSGLSRK-------------------------KRSRAAFS 183
            ..:||:.||.....||        ..||..:|                         ||.|.:::
  Fly   276 GDSDSESDSGNEAGSS--------QNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYT 332

  Fly   184 HAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKR 248
            ..|..|||:.|...|||:...|.|:|.:|.|||.|:||||||||.|.|:    :|:.|.:..   
  Fly   333 RYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK----EHKMASMNI--- 390

  Fly   249 VPVQVLVREDG------------STTYAHMAAPGAGH--GLDPALINIYRHQLQLAYGGLPLPQM 299
            ||..:     |            .:.:||::|..|.|  |....|..:|:.              
  Fly   391 VPYHM-----GPYGHPYHQFDIHPSQFAHLSAXDAWHFSGTGXRLNQLYQE-------------- 436

  Fly   300 QMPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPI-------------PGAVRPQRTPC 351
                               |.|:::..:|:|...|....||             ||::....:..
  Fly   437 -------------------PYQTAAAASAASGYQSQDGGPIGGGSVGVGGGAGGPGSLANGGSNG 482

  Fly   352 PSPNGQMMSVESGAES------------------VHSAAED--VDENVEID 382
            ..||....|..|.:::                  .|...:|  :|.|.|.|
  Fly   483 SGPNSLFASAASSSQAPDCIKYPQEFXSQVIIRQQHQQQQDNSMDRNQERD 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.