DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Lim3

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001260559.1 Gene:Lim3 / 35184 FlyBaseID:FBgn0002023 Length:555 Species:Drosophila melanogaster


Alignment Length:265 Identity:46/265 - (17%)
Similarity:80/265 - (30%) Gaps:100/265 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLC--------------------------- 69
            :.:|....::....:|.||.:.....|.|::..:.|.|                           
  Fly    85 QQHPHHNHLAVDQDDPNPELVLALISRNRALEATIPKCGGCHELILDRFILKVLERTWHAKCLQC 149

  Fly    70 -------------------CR--------------DLGLYKLTQPKEIQPSARQPSNYLQYYAAA 101
                               |:              |:|:    .|.::...|:....:||.:..|
  Fly   150 SECHGQLNDKCFARNGQLFCKEDFFKRYGTKCSACDMGI----PPTQVVRRAQDNVYHLQCFLCA 210

  Fly   102 MDNNNHHHQATGTSNSSAADYM--QRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPPLSSSPSESP 164
            |        .:.|.|:....|:  .|||.              |..:..:..:          ..
  Fly   211 M--------CSRTLNTGDEFYLMEDRKLI--------------CKRDYEEAKA----------KG 243

  Fly   165 LSHDGS--GLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRR 227
            |..|||  |....||.|...:..|:..|:..:......:...|.::::...|....|::||||||
  Fly   244 LYLDGSLDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQDTGLDMRVVQVWFQNRR 308

  Fly   228 YKTKR 232
            .|.||
  Fly   309 AKEKR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 13/52 (25%)
Lim3NP_001260559.1 LIM1_Lhx3_Lhx4 122..173 CDD:188754 2/50 (4%)
LIM2_Lhx3_Lhx4 181..236 CDD:188762 15/80 (19%)
Homeobox 259..312 CDD:278475 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.