DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and HOXD8

DIOPT Version :9

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_062458.1 Gene:HOXD8 / 3234 HGNCID:5139 Length:290 Species:Homo sapiens


Alignment Length:149 Identity:47/149 - (31%)
Similarity:68/149 - (45%) Gaps:23/149 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 DYMQRKLAYFGSTLAAPLDMRRCTSNDSDCDSPPP---LSSSPSE-----SPLSHDGSGLSRKKR 177
            |.:||:..:.....|..:....|.|:..:....|.   .|||||:     .|.:..|     ::|
Human   140 DNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPG-----RRR 199

  Fly   178 SRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAAL 242
            .|..:|..|..|||:.|....||:...|.|::.:|.|||.||||||||||.|.|::..:.     
Human   200 GRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKD----- 259

  Fly   243 LGASKRVPVQVLVREDGST 261
                 :.||.....:||.|
Human   260 -----KFPVSRQEVKDGET 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeobox 178..231 CDD:278475 26/52 (50%)
HOXD8NP_062458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..127
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..200 10/43 (23%)
Homeobox 201..253 CDD:278475 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..290 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.