DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bap and Lbx2

DIOPT Version :10

Sequence 1:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_034822.1 Gene:Lbx2 / 16815 MGIID:1342288 Length:195 Species:Mus musculus


Alignment Length:233 Identity:69/233 - (29%)
Similarity:89/233 - (38%) Gaps:86/233 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQP 86
            |||||.|||   .|     |.|...|...:|.     |.....:.|||    .|.:|.....:..
Mouse     9 TPFSIADIL---GP-----SMVPEAPSAPQLP-----EAGPDPASPLC----ALEELASKTFLGH 56

  Fly    87 SAR---QPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDS 148
            |.|   |||                                       ...|||           
Mouse    57 SPRATPQPS---------------------------------------EGRAAP----------- 71

  Fly   149 DCDSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLR 213
              ::||        .|    |:|:.|:::||.||:..||.||||||..|:||:..||..:|..|.
Mouse    72 --EAPP--------GP----GAGVRRRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLAARLG 122

  Fly   214 LTETQVKIWFQNRRYKTKR--KQIQQHEAALLGASKRV 249
            |...||..||||||.|.||  ::::...|:|.|.|..|
Mouse   123 LANAQVVTWFQNRRAKLKRDVEEMRADVASLCGLSPGV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bapNP_732637.1 Homeodomain 176..232 CDD:459649 29/55 (53%)
Lbx2NP_034822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 34/160 (21%)
Homeodomain 85..141 CDD:459649 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..195
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.