DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ETHR and PK2-R2

DIOPT Version :8

Sequence 1:NP_001287439.1 Gene:ETHR / 42523 FlyBaseID:FBgn0038874 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster

Alignment Length:509 Identity:136/510 (27%)
Similarity:219/510 (43%) Gaps:93/510 (18%)


  Fly     3 PQIPSYIRTTAMFFCIVIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTPTV 67
            |..|..:..|......:|.:.||:||::..|||.:...|..:||.:|.||:|:|:::|....|..
  Fly    59 PMTPLSLLATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDMILLCSGMPQD 123

  Fly    68 LVEVNTRPETWVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILI 132
            |..: ..|:.:.....:|.....:..|.|:|:||||.|.:.|||.|||.|.:...:....||:..
  Fly   124 LYNL-WHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQHTMSKLSRAVKF 187

  Fly   133 CVLAWGIAALFTSPILWVAEYKLAEYIDGSSVAVCLTQAISDWTLAFFLMTISVFFVVPFVTLVV 197
            ....|..|.|...|  ...::.:.....|:|   |..:  :|:....|.::..:||..|...:.|
  Fly   188 IFAIWIAALLLALP--QAIQFSVVMQGMGTS---CTMK--NDFFAHVFAVSGFLFFGGPMTAICV 245

  Fly   198 LYGIIARNLVSNRAAMLRARPTK---PELSLKARKQVVLMLGAVVLSFFVCLLPFRVLTLWIILS 259
            ||.:|...|  .|:.:|:|.|.:   ....:.|:.:|:.||.||.::||:|..||....|..:..
  Fly   246 LYVLIGVKL--KRSRLLQALPRRCYDVNRGISAQTRVIRMLVAVAVAFFICWAPFHAQRLMAVYG 308

  Fly   260 TDQTLHDLGLVRYYSLL-YFCRIMLYLNSAMNPILYNLMSTKFRRGFKRLCQDAGRLLLELVTLG 323
            :...:........:|:| |...::.:|::.:||:|||:||.|||..||             |||.
  Fly   309 STSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAFK-------------VTLA 360

  Fly   324 RR----KEDSSRG---------RRGTLSLGMGTNTNTNTNSSNATGATSSSILSRSSNRRCSEDI 375
            |.    .::..||         |..|.||.:.|..:..|..::.  ||:::.|:.|:|       
  Fly   361 RHFGLGGKNQGRGLPHTYSALRRNQTGSLRLHTTDSVRTTMTSM--ATTTTGLNGSAN------- 416

  Fly   376 SRTRLKIEMQMPCGSDLEAMAMLQHSTLGKGI-ARRVS-DSRLMPLRNH-------QPRRH-KPQ 430
                         ||.       ..:|.|:.: ..||| ||..|..:|.       .|||. :.|
  Fly   417 -------------GSG-------NGTTTGQSVRLNRVSLDSVQMQGQNRSRQDLFDNPRRMLQTQ 461

  Fly   431 I----------SFDEESLEENKRSEAKIPTKCR-EKLP---GIAREIVNLTENT 470
            |          |..||.|:.......:.||.|. ::|.   .|:|..:.||..|
  Fly   462 ISQLSSVGDAHSLLEEDLQFPGEPLQRQPTMCSIDELTDDLAISRSRLKLTRIT 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ETHRNP_001287439.1 7tm_4 18..>143 CDD:304433 41/125 (33%)
7tm_1 27..294 CDD:278431 75/271 (28%)
7tm_4 <102..307 CDD:304433 61/209 (29%)
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 75/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C68214600
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24243
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5416
33.060

Return to query results.
Submit another query.