DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment meigo and Tango9

DIOPT Version :10

Sequence 1:NP_650949.1 Gene:meigo / 42510 FlyBaseID:FBgn0250820 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_313297.3 Gene:Tango9 / 1274209 VectorBaseID:AGAMI1_003021 Length:383 Species:Anopheles gambiae


Alignment Length:74 Identity:17/74 - (22%)
Similarity:28/74 - (37%) Gaps:16/74 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 NEPDGVVVV------W------NTKFKKQTPEEVFHCQSAVMSTCFAKFHPNL---ILGGTYSG- 363
            |:|..::::      |      ::.:....|.:.|.....|.|.||.:....:   ||..|..| 
Mosquito    27 NDPVRIIILIAAAFFWLLSLLISSLWYALIPLKEFLAFGVVFSVCFQEAFRYIIYRILRSTEQGL 91

  Fly   364 QIVLWDNRV 372
            ..|..|.||
Mosquito    92 HAVAEDTRV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meigoNP_650949.1 UAA 8..311 CDD:462479
Tango9XP_313297.3 RhaT 44..>237 CDD:440461 14/57 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.