DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and Ftsj3

DIOPT Version :8

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001012014.1 Gene:Ftsj3 / 303608 RGDID:1307110 Length:829 Species:Rattus norvegicus

Alignment Length:323 Identity:103/324 (32%)
Similarity:156/324 (48%) Gaps:40/324 (12%)


  Fly     2 GRTSKDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYEP 66
            |:..|.:||.||.||||.|:|:||||||:|.:..||.|:.....:|||||||.|.||.||  :.|
  Rat     5 GKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQVAAK--FMP 67

  Fly    67 LPPEEREKVKIIAVDLQGMAPIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGMH 131
            :      ...|:.|||..:.|:..|..|:.||:.|...:|:.:.....|..:|::||||:.....
  Rat    68 V------SSLIVGVDLVPIKPLPNVVTLQEDITTERCRQALRKELKTWKVDVVLNDGAPNVGASW 126

  Fly   132 DFDSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSSI 196
            ..|:|.|..|.|.||.::...|..||.|::|::|:.....|....::.|..|...||.|||:.|.
  Rat   127 VHDAYSQAHLTLMALRLACDFLARGGCFITKVFRSRDYQPLLWIFQQLFHRVQATKPQASRHESA 191

  Fly   197 EAFVVAREFCLPDGYKPCNLTTEWHDQPESWVGRKKESPPVVQVPFVAYK-----GELDSDRTYD 256
            |.|||.:.|..||     .:..::.|...::...:.::..|.::  |..|     |..:.|.|  
  Rat   192 EIFVVCQGFLAPD-----KVDAKFFDPKFAFKEVEVQAKTVTEL--VTKKKPKAEGYAEGDLT-- 247

  Fly   257 LGENYVYKEPVQQPLTAAYQ-DILQKTSQVNIKYEGIRVIHDEEMLKKWLENDENKSEKLGAC 318
                ..::..|...|.||.. |.|.|.|:::        |.|:|     |......:|.:.||
  Rat   248 ----LYHRTSVTDFLRAANPVDFLSKASEIS--------IDDKE-----LAQHPATTEDIRAC 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 77/201 (38%)
Ftsj3NP_001012014.1 RlmE 8..203 CDD:223370 78/203 (38%)
DUF3381 232..397 CDD:288694 19/82 (23%)
Spb1_C 628..823 CDD:285075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1362679at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.