DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7009 and R74.7

DIOPT Version :8

Sequence 1:NP_650947.1 Gene:CG7009 / 42508 FlyBaseID:FBgn0038861 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_497843.1 Gene:R74.7 / 175543 WormBaseID:WBGene00011281 Length:337 Species:Caenorhabditis elegans

Alignment Length:299 Identity:144/300 (48%)
Similarity:199/300 (66%) Gaps:30/300 (10%)


  Fly     1 MGRTSKDKRDIFYRLAKEQGWRARSAFKLLQADETFQLLEGLTRAVDLCAAPGSWSQVLAKRLYE 65
            ||:||:|||||:||||||..|||||||||:|.|:.||:|:|:.||||||||||||||||:|||| 
 Worm     1 MGKTSRDKRDIYYRLAKENKWRARSAFKLMQIDDEFQILKGVRRAVDLCAAPGSWSQVLSKRLY- 64

  Fly    66 PLPPEEREKVKIIAVDLQGMAPIEGVKQLRADISKESTAEAIIEFFGGEKAQIVVSDGAPDSTGM 130
                ||.::.||:|:|||.||||.||.||:.||:...||..:|:.|.|||:.||:.|||||.||:
 Worm    65 ----EEDQEAKIVAIDLQPMAPIPGVIQLQGDITSVDTANQVIKHFSGEKSDIVICDGAPDVTGI 125

  Fly   131 HDFDSYVQGELLLSALSISTFILEEGGSFVSKIYRADRTSRLYTQLKRFFKNVCVFKPSASRNSS 195
            |..|.::|.||:|:|.:|::.:|:|||:|::||:|:..:|.||.|:|::||.|.:.||.:||.||
 Worm   126 HSLDEFMQAELILAAFNITSHVLKEGGNFLAKIFRSRNSSLLYAQMKKYFKKVYLAKPRSSRQSS 190

  Fly   196 IEAFVVAREFCLPDGYKPCNLTTEWHDQPESWVGRKKESPPVVQVPFVAYKGEL---DSDRTYDL 257
            .||||:..::..|:|:.|....|.......|.:     ||.::. .||.. |:|   ||:::|.|
 Worm   191 CEAFVLCLDYSPPEGFVPTMGKTSLDATDASAI-----SPDIID-GFVTC-GDLSGWDSEKSYPL 248

  Fly   258 --------GE-------NYVYKEPVQQPLTAAYQDILQK 281
                    ||       .|.:|:.||.|...||:..|.|
 Worm   249 DIDACFPKGEIDEEQKKRYEFKDVVQPPTDPAYKAALDK 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7009NP_650947.1 RlmE 4..205 CDD:223370 116/201 (58%)
R74.7NP_497843.1 RlmE 3..204 CDD:223370 117/206 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C249328399
eggNOG 1 0.900 E1_COG0293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1362679at2759
OrthoFinder 1 1.000 FOG0003459
OrthoInspector 1 1.000 T375263
orthoMCL 1 0.900 OOG5_127766
Panther 1 1.100 O PTHR10920
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.