DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bdbt and Ttc9c

DIOPT Version :10

Sequence 1:NP_650943.1 Gene:Bdbt / 42503 FlyBaseID:FBgn0038857 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001007694.1 Gene:Ttc9c / 309196 RGDID:1359253 Length:171 Species:Rattus norvegicus


Alignment Length:173 Identity:47/173 - (27%)
Similarity:80/173 - (46%) Gaps:30/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 EKLSAAEIYEVALRLKESGVATFKTFPKFAFDYFVRAAKLLITYKPFDKLTKK---TNGINGQAV 185
            ::|..|::|      ||.|...::. .|:. |...|..:.|:..:..|.....   ..|..|.|:
  Rat     3 KRLQEAQLY------KEEGNQRYRE-GKYR-DAVSRYHRALLQLRGLDPSLPSPIPNLGPQGPAL 59

  Fly   186 ----EELFIQIQT----NLAACLLQEK--RYEHVIYHTQFVETEESPSEKSIYRRALAYYHLKEF 240
                |.:...|||    ||||||||.:  :||.|..::|.|...:..:.|::||..:|::||:::
  Rat    60 TPEQENILHTIQTDCYNNLAACLLQMEPVKYERVREYSQKVLERQPENAKALYRAGVAFFHLQDY 124

  Fly   241 AKAQ----ATIERMPNYEEKREFSKLRDNIAVSWKDSKAHYKE 279
            .:|:    |.:.|.|.....|.:.:|..:...|:     |.||
  Rat   125 DQARHYLLAAVNRQPKDANVRRYLQLTQSELSSY-----HRKE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BdbtNP_650943.1 FKBP_N_2 9..117 CDD:375495
Ttc9cNP_001007694.1 Spy 2..>148 CDD:443119 42/152 (28%)
TPR 1 8..41 9/40 (23%)
TPR repeat 8..36 CDD:276809 8/35 (23%)
TPR repeat 45..103 CDD:276809 20/57 (35%)
TPR 2 72..107 14/34 (41%)
TPR 3 108..141 10/32 (31%)
TPR repeat 108..135 CDD:276809 8/26 (31%)
TPR repeat 142..165 CDD:276809 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.