DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bdbt and TTC9

DIOPT Version :10

Sequence 1:NP_650943.1 Gene:Bdbt / 42503 FlyBaseID:FBgn0038857 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_056166.1 Gene:TTC9 / 23508 HGNCID:20267 Length:222 Species:Homo sapiens


Alignment Length:63 Identity:24/63 - (38%)
Similarity:37/63 - (58%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 QAVEELFIQIQTNLAACLLQEK--RYEHVIYHTQFVETEESPSEKSIYRRALAYYHLKEFAKA 243
            :.||.:.|....:|||||||.:  .||.|..:...|..:|..:.|::||..:|:|||.::.||
Human   121 KTVEAIEIDCYNSLAACLLQAELVNYERVKEYCLKVLKKEGENFKALYRSGVAFYHLGDYDKA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BdbtNP_650943.1 FKBP_N_2 9..117 CDD:375495
TTC9NP_056166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
TPR 1 56..89
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..116
TPR <124..>213 CDD:440225 23/60 (38%)
TPR 2 125..160 12/34 (35%)
TPR repeat 130..159 CDD:276809 11/28 (39%)
TPR 3 161..194 9/23 (39%)
TPR repeat 164..190 CDD:276809 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.