DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and YOX1

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae

Alignment Length:314 Identity:74/315 (23%)
Similarity:115/315 (37%) Gaps:82/315 (26%)


  Fly     7 SSKAAFSIENILEQKSSSHRSQSRRGSSQSPVAVTAGIATPHAL---------AMPKASLATGSS 62
            ||..:.|..|   .::|.|...  ||:.:.| .:...|..|.::         ::.:.|.|.|..
Yeast    22 SSPVSPSFTN---PRTSFHLDD--RGTIKLP-PLNTSINRPRSVESALRHTVTSLHENSSAYGDD 80

  Fly    63 SAAPTPSPSSATNIYDLSREAAAAQYAMKSMDSSAVLAPTSLRFNPIYPDPASLFYQQVLQLQKN 127
            ....|.|.|:      ||.:..::|..:.....:.:|.|.:           |......:..:||
Yeast    81 MLKHTQSDSA------LSSQLNSSQETVDESHENLLLTPLN-----------SKKRDYSVSSKKN 128

  Fly   128 PSLFMPHFQAAAVAAAAAVQPTAYCDQYSPF---TMDCEGFP--NPASAAAALYCNAYPAASFYM 187
            ..|      ....||.:.:.|:|..::...|   |...|.||  .|....|.|            
Yeast   129 DIL------TPLSAAKSIIIPSASKEKRRAFAFITHSQETFPKKEPKIDNAPL------------ 175

  Fly   188 SNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRR--AKWR 250
                .:||  :.|.:||:...|:|.|......|.|:|..||....:|::.|:.||||:|  .|.:
Yeast   176 ----ARRK--RRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQ 234

  Fly   251 RANLSKRSASAQ-------------GPIAGAAV------GSPSSASSSSVPVLN 285
            |...||.:...|             .|:|....      ||..|.||||.|:.|
Yeast   235 RIATSKSTTIIQTVSPPSPPLDVHATPLASRVKADILRDGSSCSRSSSSSPLEN 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 19/52 (37%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 42/165 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24324
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.