DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and ATHB13

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana

Alignment Length:69 Identity:28/70 (40%)
Similarity:35/70 (50%) Gaps:4/70 (6%)


  Fly   188 SNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRA 252
            |..|.|::    |...:|.|.||..|.....|.||.:..||..|.|..||:..|||||||:|:..
plant    80 SQMGEKKR----RLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTK 140

  Fly   253 NLSK 256
            .|.|
plant   141 QLEK 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 23/50 (46%)
ATHB13NP_177136.1 Homeobox 85..138 CDD:278475 24/57 (42%)
HALZ 140..181 CDD:280364 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124708
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.