DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and AtHB23

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana

Alignment Length:106 Identity:31/107 (29%)
Similarity:43/107 (40%) Gaps:2/107 (2%)


  Fly   153 DQYSPFTMDCEGFPNPASAAAAL--YCNAYPAASFYMSNFGVKRKGGQIRFTSQQTKNLEARFAS 215
            :.:.....|..||....|....:  :||.........|:.|.|....:.|...:|.|.||..|..
plant    25 EDHPQLLQDFHGFLGKRSPMNNVQGFCNLDMNGDEEYSDDGSKMGEKKRRLNMEQLKALEKDFEL 89

  Fly   216 SKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSK 256
            ...|..:.:..||..|.|..||:..|||||||:.:...|.|
plant    90 GNKLESDRKLELARALGLQPRQIAIWFQNRRARSKTKQLEK 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 20/50 (40%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 20/53 (38%)
HALZ 126..167 CDD:280364 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124708
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.