DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and HB51

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana

Alignment Length:79 Identity:28/80 (35%)
Similarity:41/80 (51%) Gaps:6/80 (8%)


  Fly   178 NAYPAASFYMSNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWF 242
            |||...:  .:|..:|:|    |.||.|..:||..|.....|..:.:..|:.:|.|..||:..||
plant    64 NAYRFPN--NNNEMIKKK----RLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWF 122

  Fly   243 QNRRAKWRRANLSK 256
            |||||:|:...|.:
plant   123 QNRRARWKAKQLEQ 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 21/50 (42%)
HB51NP_195999.2 Homeobox 77..130 CDD:278475 23/57 (40%)
HALZ 132..166 CDD:280364 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124708
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
21.910

Return to query results.
Submit another query.