DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and HAT14

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_196289.2 Gene:HAT14 / 830560 AraportID:AT5G06710 Length:336 Species:Arabidopsis thaliana


Alignment Length:58 Identity:25/58 - (43%)
Similarity:35/58 - (60%) Gaps:2/58 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAK 248
            |..||  ::|.:..|:..||..|.....|:|:::..||.||.|..|||:.|||||||:
plant   186 GSTRK--KLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRAR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 22/49 (45%)
HAT14NP_196289.2 HOX 187..243 CDD:197696 24/57 (42%)
HALZ 245..288 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.