powered by:
Protein Alignment HHEX and HAT14
DIOPT Version :9
| Sequence 1: | NP_650938.2 |
Gene: | HHEX / 42495 |
FlyBaseID: | FBgn0038852 |
Length: | 323 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_196289.2 |
Gene: | HAT14 / 830560 |
AraportID: | AT5G06710 |
Length: | 336 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 58 |
Identity: | 25/58 - (43%) |
| Similarity: | 35/58 - (60%) |
Gaps: | 2/58 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 191 GVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAK 248
|..|| ::|.:..|:..||..|.....|:|:::..||.||.|..|||:.|||||||:
plant 186 GSTRK--KLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRAR 241
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| HHEX | NP_650938.2 |
Homeobox |
200..250 |
CDD:278475 |
22/49 (45%) |
| HAT14 | NP_196289.2 |
HOX |
187..243 |
CDD:197696 |
24/57 (42%) |
| HALZ |
245..288 |
CDD:128634 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0483 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.