DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and HB6

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana

Alignment Length:125 Identity:38/126 (30%)
Similarity:51/126 (40%) Gaps:20/126 (16%)


  Fly   139 AVAAAAAVQPTAYCDQYSP-------FTMDCEGFPNPASAAAALYCNAYPAASFYMSNFGVKRKG 196
            :|....::.||...|:.||       |....||:.....|...           ...:.|:..| 
plant    10 SVGGLISLCPTTSTDEQSPRRYGGREFQSMLEGYEEEEEAIVE-----------ERGHVGLSEK- 62

  Fly   197 GQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSK 256
             :.|.:..|.|.||..|.....|.||.:..||.:|.|..|||..|||||||:|:...|.|
plant    63 -KRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEK 121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 24/50 (48%)
HB6NP_565536.1 Homeobox 62..115 CDD:278475 25/55 (45%)
HALZ 117..158 CDD:280364 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124708
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.