DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and HB17

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:179 Identity:44/179 - (24%)
Similarity:73/179 - (40%) Gaps:23/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YAMKSMDSSAVLAPTSLRFNPIYPDPASLFY-------------QQVLQLQKNPSLFMPHFQAAA 139
            ||:..||.:.|   ...::..|......|||             ..:|.| |||:..:....|..
plant    17 YALYHMDYACV---CMYKYKGIVTLQVCLFYIKLRVFLSNFTFSSSILAL-KNPNNSLIKIMAIL 77

  Fly   140 VAAAAAVQPTAYCDQYSPFTMDCEGFPNPASAAAALYCNAYPAA-----SFYMSNFGVKRKGGQI 199
            ...::.:..|.....:|...:..|| .........|..|..|::     ..:..:.|......::
plant    78 PENSSNLDLTISVPGFSSSPLSDEG-SGGGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKL 141

  Fly   200 RFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAK 248
            |.|.:|::.||..|..:..|:|:::..||..|.|..||::.|||||||:
plant   142 RLTREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRAR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 21/49 (43%)
HB17NP_178252.2 HOX 136..192 CDD:197696 21/55 (38%)
HALZ 194..237 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.