DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and HOXC12

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_776272.1 Gene:HOXC12 / 3228 HGNCID:5124 Length:282 Species:Homo sapiens


Alignment Length:94 Identity:32/94 - (34%)
Similarity:49/94 - (52%) Gaps:8/94 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NPASAAAALYCNAYPAASFYMSNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQL 231
            ||....:|.....||    ..|....|||    .::..|...||..|..:::::.:.||.|:.:|
Human   195 NPGGGLSASGAPWYP----INSRSRKKRK----PYSKLQLAELEGEFLVNEFITRQRRRELSDRL 251

  Fly   232 KLTDRQVKTWFQNRRAKWRRANLSKRSAS 260
            .|:|:|||.||||||.|.:|..|.:::.|
Human   252 NLSDQQVKIWFQNRRMKKKRLLLREQALS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 20/50 (40%)
HOXC12NP_776272.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..129
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..214 6/22 (27%)
Homeodomain 215..271 CDD:459649 23/59 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.