DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and HHEX

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_002720.1 Gene:HHEX HGNCID:4901 Length:270 Species:Homo sapiens

Alignment Length:314 Identity:95/315 (30%)
Similarity:120/315 (38%) Gaps:110/315 (35%)


  Fly    55 ASLATGSSSAAPTP--SPSSATNIY--DLSREAAAAQYAMKSMDSSAVLAPTSLRFNPIYPDPAS 115
            |:.|.|....||||  .|:..|..|  |:.....|              |||..   |..|.|.|
Human     9 AAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPA--------------APTPA---PTLPSPNS 56

  Fly   116 LFYQQVLQLQK---NPSLFMP---HFQAAAVAAAAAVQPTAYCDQYSPFTMDCEGFPNPASAAAA 174
            .|...|...:.   .|:...|   |..|||:|||           |.|     .||..|      
Human    57 SFTSLVSPYRTPVYEPTPIHPAFSHHSAAALAAA-----------YGP-----GGFGGP------ 99

  Fly   175 LY-----CNAYPAASFYMSNFGV-------------KRKGGQIRFTSQQTKNLEARFASSKYLSP 221
            ||     .|.|..|.......|.             ||||||:||::.||..||.:|.:.|||||
Human   100 LYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSP 164

  Fly   222 EERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSKRSASAQGPIAGAAVGSPSSASSSSVPVLNL 286
            .||:.||..|:|::||||||||||||||||....                :|.|.....:..|: 
Human   165 PERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQE----------------NPQSNKKEELESLD- 212

  Fly   287 GSGSRCGQQSD----------------------EED-RMYLSEDDEDDDEDEGE 317
               |.|.|:.|                      :|| ...:|||.:.:.:.||:
Human   213 ---SSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGD 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 32/50 (64%)
HHEXNP_002720.1 Homeobox 143..193 CDD:306543 28/63 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5009
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006547
OrthoInspector 1 1.000 T1073899
orthoMCL 1 0.900 OOG5_135284
Panther 1 1.100 LDO PTHR24324
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3866
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.