DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and hhex

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_571009.1 Gene:hhex ZFINID:ZDB-GENE-980526-299 Length:228 Species:Danio rerio

Alignment Length:288 Identity:84/289 (29%)
Similarity:118/289 (41%) Gaps:104/289 (36%)


  Fly    12 FSIENILEQKSSSHRSQSRRGSSQSPVAVTAGIATPHALAMPKASLATGSSSAAPTPSPSSATNI 76
            |.||:||          .|.|||..||..|..:.:|              :|:..:..||..|.|
Zfish    24 FYIEDIL----------GRTGSSSGPVVPTPTLPSP--------------NSSFTSLIPSYRTPI 64

  Fly    77 YDLSREAAAAQYAMKSMDSSAVLAPTSLRFNPIYPDPASLFYQQVLQLQKNPSLFMPHFQAAAVA 141
            |:|:                           ||:|           .|.:..|:: |..::....
Zfish    65 YELT---------------------------PIHP-----------VLSQYASMY-PFQRSVGDF 90

  Fly   142 AAAAVQ--PTAYCDQYSPFTMDCEGFPNPASAAAALYCNAYPAASFYMSNFGVKRKGGQIRFTSQ 204
            |.|.::  |......:|||      ...|..                      ||||||:||::.
Zfish    91 AHALIRHDPLGKPLLWSPF------IQRPLH----------------------KRKGGQVRFSND 127

  Fly   205 QTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRR------ANLSKRSA--SA 261
            ||..||.:|.:.|||||.||:.||..|:|::||||||||||||||||      .:..||.|  |.
Zfish   128 QTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPPSTGKREAEDSD 192

  Fly   262 QGPIAGAAVGS---PSSASSSSVPVLNL 286
            ...::.||..:   .|.||:.|..:|::
Zfish   193 TRRLSDAAARARELESGASTDSEELLDI 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 32/50 (64%)
hhexNP_571009.1 Homeobox 123..173 CDD:278475 32/50 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006547
OrthoInspector 1 1.000 T597352
orthoMCL 1 0.900 OOG5_135284
Panther 1 1.100 LDO PTHR24324
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3866
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.