DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and hhex

DIOPT Version :9

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_571009.1 Gene:hhex / 30098 ZFINID:ZDB-GENE-980526-299 Length:228 Species:Danio rerio


Alignment Length:288 Identity:84/288 - (29%)
Similarity:118/288 - (40%) Gaps:104/288 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSIENILEQKSSSHRSQSRRGSSQSPVAVTAGIATPHALAMPKASLATGSSSAAPTPSPSSATNI 76
            |.||:||          .|.|||..||..|..:.:|              :|:..:..||..|.|
Zfish    24 FYIEDIL----------GRTGSSSGPVVPTPTLPSP--------------NSSFTSLIPSYRTPI 64

  Fly    77 YDLSREAAAAQYAMKSMDSSAVLAPTSLRFNPIYPDPASLFYQQVLQLQKNPSLFMPHFQAAAVA 141
            |:|:                           ||:|           .|.:..|:: |..::....
Zfish    65 YELT---------------------------PIHP-----------VLSQYASMY-PFQRSVGDF 90

  Fly   142 AAAAVQ--PTAYCDQYSPFTMDCEGFPNPASAAAALYCNAYPAASFYMSNFGVKRKGGQIRFTSQ 204
            |.|.::  |......:|||      ...|..                      ||||||:||::.
Zfish    91 AHALIRHDPLGKPLLWSPF------IQRPLH----------------------KRKGGQVRFSND 127

  Fly   205 QTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRR------ANLSKRSA--SA 261
            ||..||.:|.:.|||||.||:.||..|:|::||||||||||||||||      .:..||.|  |.
Zfish   128 QTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPPSTGKREAEDSD 192

  Fly   262 QGPIAGAAVGS---PSSASSSSVPVLNL 286
            ...::.||..:   .|.||:.|..:|::
Zfish   193 TRRLSDAAARARELESGASTDSEELLDI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 31/49 (63%)
hhexNP_571009.1 Homeobox 123..173 CDD:278475 31/49 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..228 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8970
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto41266
orthoMCL 1 0.900 - - OOG6_108938
Panther 1 1.100 - - LDO PTHR24324
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3866
SonicParanoid 1 1.000 - - X5578
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.