DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and VENTX

DIOPT Version :10

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_055283.1 Gene:VENTX / 27287 HGNCID:13639 Length:258 Species:Homo sapiens


Alignment Length:122 Identity:40/122 - (32%)
Similarity:62/122 - (50%) Gaps:12/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 PNPASAAAALYCNAYPAASFYMSNFGVKRKGGQIR-------FTSQQTKNLEARFASSKYLSPEE 223
            |...|...|...:..||....|:  |:.::...:|       ||.:|.:.||..|...:||||.|
Human    58 PQAVSIKEAAGSSNLPAPERTMA--GLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE 120

  Fly   224 RRHLALQLKLTDRQVKTWFQNRRAKWRRANLSKRSASAQGPIAGAAVGSPSSASSSS 280
            |:.||.:::|::.|:||||||||.|.:|   ..:......|.:|:....|:..|:||
Human   121 RKRLAREMQLSEVQIKTWFQNRRMKHKR---QMQDPQLHSPFSGSLHAPPAFYSTSS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeodomain 200..251 CDD:459649 26/57 (46%)
VENTXNP_055283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 8/36 (22%)
Homeodomain 93..148 CDD:459649 25/54 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.