DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and yox1

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_595674.1 Gene:yox1 PomBaseID:SPBC21B10.13c Length:201 Species:Schizosaccharomyces pombe

Alignment Length:61 Identity:22/62 (35%)
Similarity:34/62 (55%) Gaps:2/62 (3%)


  Fly   200 RFTSQQTKNLEARFASSKYLSPEERRHLALQLK--LTDRQVKTWFQNRRAKWRRANLSKRS 258
            |.|..:...||..|..:...|..||:.|:.:||  :|.|:::.||||:|...||:|...|:
pombe    39 RTTDAEATLLEQYFLKTPKPSLIERQELSKKLKSSMTPRELQIWFQNKRQSLRRSNCLSRN 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 18/52 (35%)
yox1NP_595674.1 COG5576 1..141 CDD:227863 22/62 (35%)
homeodomain 34..94 CDD:238039 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24324
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.