DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and pha-2

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_508131.4 Gene:pha-2 WormBaseID:WBGene00004011 Length:214 Species:Caenorhabditis elegans

Alignment Length:244 Identity:77/245 (31%)
Similarity:99/245 (40%) Gaps:67/245 (27%)


  Fly    59 TGSSSAAPTPSPSSATNIYDLSREAAAAQYAMKSMDSSAVLAPTSLRFNPIYPDPASLFYQQVLQ 123
            |.|.|..||.|..|.....|.:.:        :.|:.:..:...:|.|||.....:.....|:.|
 Worm    23 TSSESPIPTGSECSLNESSDTTLD--------QKMEPNKKMFNGTLDFNPWICHVSQQLAAQLSQ 79

  Fly   124 LQKNPSLFMPHFQAAAVAAAAAVQPTAYCDQYSPFTMDCEGFPNPASAAAALYCNA--------- 179
            ..||                   :|               |.||   ....|..|.         
 Worm    80 NGKN-------------------RP---------------GAPN---QVPLLNMNVNQTMGNMWD 107

  Fly   180 ------YPAASFYMSNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQV 238
                  ||    |||....||||||||||::||..||.:|.|.|||||:||:.||..|.|::|||
 Worm   108 PRLSWLYP----YMSKSPQKRKGGQIRFTNEQTDALEHKFDSHKYLSPQERKKLAKSLSLSERQV 168

  Fly   239 KTWFQNRRAKWRRANLSKRSASAQGPIAGAAVGSPSSASSSSVPVLNLG 287
            |||||||||||||.   ::....:..:...|.........||.|.|:.|
 Worm   169 KTWFQNRRAKWRRV---RKDGEDEDEMPNGASARSLGQLQSSNPFLSHG 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 34/50 (68%)
pha-2NP_508131.4 Homeobox 130..180 CDD:278475 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C181854708
eggNOG 1 0.900 E1_KOG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006547
OrthoInspector 1 1.000 T477063
orthoMCL 1 0.900 OOG5_135284
Panther 1 1.100 LDO PTHR24324
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3866
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.