DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and Nkx2-9

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_032727.2 Gene:Nkx2-9 MGIID:1270158 Length:235 Species:Mus musculus

Alignment Length:131 Identity:45/132 (34%)
Similarity:57/132 (43%) Gaps:39/132 (30%)


  Fly   193 KRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSKR 257
            ||:..::.|:..||..||.||...:|||..||..||..|:||..|||.||||.|.|.:|      
Mouse    80 KRRKRRVLFSKAQTLELERRFRQQRYLSAPEREQLARLLRLTPTQVKIWFQNHRYKLKR------ 138

  Fly   258 SASAQGPIAGAAVG--SPSSASSSS-------------VPVL-------NLGSGSRCGQQSDEED 300
                     |.|.|  .||..::||             ||||       |.|.|.  |..:..:|
Mouse   139 ---------GRAPGITEPSDMAASSDLHAAPGLLRRVVVPVLVHDRPPSNNGRGE--GTSAVPQD 192

  Fly   301 R 301
            :
Mouse   193 K 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 26/50 (52%)
Nkx2-9NP_032727.2 HAUS4 7..>120 CDD:291405 17/40 (43%)
Homeobox 84..137 CDD:278475 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.