DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HHEX and ceh-51

DIOPT Version :9

Sequence 1:NP_650938.2 Gene:HHEX / 42495 FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_507685.1 Gene:ceh-51 / 180233 WormBaseID:WBGene00013583 Length:234 Species:Caenorhabditis elegans


Alignment Length:201 Identity:61/201 - (30%)
Similarity:81/201 - (40%) Gaps:31/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PSSATNIYDLSREAAAAQYAMKSMDSSAVLAPTSLRFNPIYP------------DPASLFYQQVL 122
            |.|::|:...|....|......:|.||   :|.|:..:|.||            ||..|:|||.|
 Worm    16 PLSSSNLNSTSAITNATVMEYSTMPSS---SPGSMSSSPAYPAAYQAPSPCYVADPNQLYYQQQL 77

  Fly   123 QLQKNPSLFMPHFQAAAVAAAAAVQPTAYCDQYSPFTMDCEGFPNPASAAAALYCNAYPAASFYM 187
            ....|..|...|.||......|..|     .|||  .:....||:|..|..|.:..  |..||..
 Worm    78 AHNGNDMLVQAHAQAYQAQCFAWFQ-----QQYS--QLSPSSFPHPMVAHHAGFIP--PPPSFLH 133

  Fly   188 SNF-------GVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNR 245
            ...       ..||:|.:..|:..|...|..||.....:..:|||.|...:.|:..|:|.|||||
 Worm   134 HQHQQHPRAPSEKRRGARTPFSDSQLYALRTRFEQCDTIKVDERRKLGAVIGLSPEQIKIWFQNR 198

  Fly   246 RAKWRR 251
            |.|.|:
 Worm   199 RFKLRK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 19/49 (39%)
ceh-51NP_507685.1 Homeobox 151..204 CDD:365835 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.