| Sequence 1: | NP_650938.2 | Gene: | HHEX / 42495 | FlyBaseID: | FBgn0038852 | Length: | 323 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_032271.1 | Gene: | Hhex / 15242 | MGIID: | 96086 | Length: | 271 | Species: | Mus musculus |
| Alignment Length: | 305 | Identity: | 97/305 - (31%) |
|---|---|---|---|
| Similarity: | 125/305 - (40%) | Gaps: | 78/305 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 47 PHALAMPKASLATGSSSAAPTP--SPSSATNIY--DLSREAAAAQYAMKSMDSSAVLAPTSLRFN 107
Fly 108 PIYPDPASLFYQQVLQLQK---NPSLFMP---HFQAAAVAAAAAVQPTAYCDQYSPFTMDCEGFP 166
Fly 167 NPASAAAALY-----CNAYPAASFYMSNFGV-------------KRKGGQIRFTSQQTKNLEARF 213
Fly 214 ASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSKRSASAQGPIAGAAVGSPSSASS 278
Fly 279 SSVP-VLNLGSG---SRCGQQ--SDEEDRMYLSEDDEDDDEDEGE 317 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| HHEX | NP_650938.2 | Homeobox | 200..250 | CDD:278475 | 31/49 (63%) |
| Hhex | NP_032271.1 | Interaction with SOX13. /evidence=ECO:0000250|UniProtKB:Q03014 | 1..138 | 44/174 (25%) | |
| Required for WNT signaling induction. /evidence=ECO:0000250|UniProtKB:Q03014 | 138..271 | 52/130 (40%) | |||
| Homeobox | 144..194 | CDD:278475 | 31/49 (63%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 195..271 | 14/73 (19%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167837319 | |
| Domainoid | 1 | 1.000 | 76 | 1.000 | Domainoid score | I8978 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG0483 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 96 | 1.000 | Inparanoid score | I5036 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | oto93268 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_108938 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR24324 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3866 |
| SonicParanoid | 1 | 1.000 | - | - | X5578 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 10 | 9.870 | |||||