DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and Hhex

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_032271.1 Gene:Hhex MGIID:96086 Length:271 Species:Mus musculus

Alignment Length:305 Identity:97/306 (32%)
Similarity:125/306 (41%) Gaps:78/306 (25%)


  Fly    47 PHALAMPKASLATGSSSAAPTP--SPSSATNIY--DLSREAAAAQYAMKSMDSSAVLAPTSLRFN 107
            ||  ..|.|:.|.|....||||  .|:..|..|  |:.....|              |||.   .
Mouse     4 PH--PGPAAAPAVGVPLYAPTPLLQPAHPTPFYIDDILGRGPA--------------APTP---T 49

  Fly   108 PIYPDPASLFYQQVLQLQK---NPSLFMP---HFQAAAVAAAAAVQPTAYCDQYSPFTMDCEGFP 166
            |..|.|.|.|...|...:.   .|:...|   |..|||:|||           |.|     .||.
Mouse    50 PTLPSPNSSFTSLVSSYRTPVYEPTPVHPAFSHHPAAALAAA-----------YGP-----SGFG 98

  Fly   167 NPASAAAALY-----CNAYPAASFYMSNFGV-------------KRKGGQIRFTSQQTKNLEARF 213
            .|      ||     .|.|..|.......|.             ||||||:||::.||..||.:|
Mouse    99 GP------LYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTVELEKKF 157

  Fly   214 ASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSKRSASAQGPIAGAAVGSPSSASS 278
            .:.|||||.||:.||..|:|::||||||||||||||||.......::.:..:...   ..|....
Mouse   158 ETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKDALDSL---DTSCEQG 219

  Fly   279 SSVP-VLNLGSG---SRCGQQ--SDEEDRMYLSEDDEDDDEDEGE 317
            ..:| ..|.|:.   |:|...  |.|:....:|||.:.:.:.||:
Mouse   220 QDLPSEQNKGASLDRSQCSPSPASQEDPDSEISEDSDQEVDIEGD 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 32/50 (64%)
HhexNP_032271.1 Homeobox 144..194 CDD:278475 32/50 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C181855245
eggNOG 1 0.900 E1_KOG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I5003
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006547
OrthoInspector 1 1.000 T1083984
orthoMCL 1 0.900 OOG5_135284
Panther 1 1.100 LDO PTHR24324
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3866
TreeFam 1 0.960
98.870

Return to query results.
Submit another query.