DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HHEX and ATHB54

Sequence 1:NP_650938.2 Gene:HHEX FlyBaseID:FBgn0038852 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001322131.1 Gene:ATHB54 AraportID:AT1G27045 Length:252 Species:Arabidopsis thaliana

Alignment Length:106 Identity:35/107 (33%)
Similarity:46/107 (43%) Gaps:21/107 (20%)


  Fly   165 FPN---PASAAAALY-----CNAYPAA--------SFYMSNFGVKRKGGQIRFTSQQTKNLEARF 213
            ||:   |.|:.:|.|     .|...|.        |:.|.....|||     .|..|.:.||..|
plant    25 FPSSCFPPSSHSAFYGSSSMINTETATMDEEDVCESYMMREITKKRK-----LTPIQLRLLEESF 84

  Fly   214 ASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANL 254
            ...|.|.|:.:..||.:|.|...||..|||||||:::...|
plant    85 EEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRARYKTKQL 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HHEXNP_650938.2 Homeobox 200..250 CDD:278475 21/50 (42%)
ATHB54NP_001322131.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124708
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.