DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15695 and CG11630

Sequence 1:NP_650920.3 Gene:CG15695 FlyBaseID:FBgn0038832 Length:725 Species:Drosophila melanogaster
Sequence 2:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster

Alignment Length:650 Identity:162/650 (25%)
Similarity:278/650 (43%) Gaps:137/650 (21%)


  Fly   154 KKYFVHSPQCQMSHPNPFANNIQHIYKKHSYIVCDKSRDMITVNYNVT---DSTYRLHKNENSTC 215
            :||.|.:..|:|....|...::..:::       ...||....|.|:|   :.||...:.|.:  
  Fly    40 EKYSVDTKGCRMLTMVPNEYDVMFLWR-------GLRRDFCASNLNLTSFSNCTYNYLRTEVN-- 95

  Fly   216 CFKQILRAGTSANADHKYKLGPC----VEFHQDFLVPTEVSAMITYCRR-----------PPFDK 265
              .::.:|.........:|   |    :|.|.||      .....|.|.           .|...
  Fly    96 --MELAKARFGVETLESFK---CMYYAMERHTDF------DNRYLYSREFELLTDGNNTIEPHAD 149

  Fly   266 VSQKDAF-----------SFVHPRKDQIENPTTPHRRRP----------SVLLWGIDSISRMNLE 309
            :.:.:.|           .:|||..:.:.   |.....|          |||:.|:||||:|:..
  Fly   150 IIRAECFINATSIYNGVHFYVHPTDEWLR---TAQGLPPLKLASDVGSLSVLIVGLDSISQMHFH 211

  Fly   310 LTMPRMYEYLNNQHWFELQGYNKMGDNTFPNLMAVLTGFN----KTYANARCHPEKVRGLDACPF 370
            .:|.|...:|.:....||:|:|::|::.|.:||.:|:|.:    |..::      .:..||:|||
  Fly   212 RSMARTANFLLSLPHVELKGFNRLGEDGFDSLMPLLSGLSGQELKDVSS------NLSSLDSCPF 270

  Fly   371 IWKDFKDKGYTTAFAEDWSKFSTFDYSSRGFFNPPTDVYGRPLVLAV---------------EKE 420
            |||.|:..||.|...||....|.|   .:||..||||.|.||.:|.:               ||:
  Fly   271 IWKVFQKAGYETGLGEDNIDKSLF---VKGFRKPPTDFYLRPALLEMWLKTRTDGLFGTHCNEKD 332

  Fly   421 LTILQRGQMPYCLGRKPASEYIYDMGVQFTMVNRNSTFFGMFWTNTFSHNDFSMPSAMDERMVKY 485
                     .|.:..:   |:::.|....|. :|..||  ::||....|. |:....:|:..:|.
  Fly   333 ---------NYAMVLR---EFLFKMLPHHTS-HRFFTF--LWWTQGIDHL-FNYGRKLDQPFLKM 381

  Fly   486 MRTLDKNGIMDNTIIIFFSDHGSRFGPLRNLDSGFVEERLPFIYIRVPRWIREKYPKLLRNLQMN 550
            .:.:.::|::.||:::..|:||...|.......|.|||..|...:..|||:.|:||:.:.||:.|
  Fly   382 FKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEESQPLAILCYPRWLEERYPQAIGNLKSN 446

  Fly   551 KNRLTSPYDIHATLRHILELDTPKDK---------------LPRPDGCSSCHSVFEEVDWSRNCS 600
            ..||.:.:|:||||:::..|.:.:|:               :||  |.    |:|..:...|:|.
  Fly   447 NRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVDLWAMGKDIPR--GI----SLFLPIPDHRDCF 505

  Fly   601 QAGIEDHWCACNSFSDVPTTDPSARSMSTQLVEAINEYVASKKGTKRCSRLKLNRISSVQ--RR- 662
            .|.|....|.|....:|.|:|...:..:..::..:|:.:.:.  |..|..|.|:|:.:..  || 
  Fly   506 LAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNLNKMIHTH--TPPCKTLYLDRVLTADKWRRI 568

  Fly   663 --GNSNRYLIQLMAQPGDALFEATVDWDASAQRIPAQMPSISRLDTYAAKSRCSSVKETKKYCIC 725
              .:.:.:.::|:|.||:..||..|.:......:...   |||::.|...|:|......:.||.|
  Fly   569 ADEHQSEFRVRLIATPGEGQFEGIVRYTGYKLAVDGH---ISRVNDYRNGSQCIRNYLIEMYCFC 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15695NP_650920.3 DUF229 180..656 CDD:281053 138/549 (25%)
ALP_like 293..571 CDD:293745 94/307 (31%)
CG11630NP_610124.1 DUF229 66..560 CDD:281053 138/550 (25%)
ALP_like 195..467 CDD:293745 93/297 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49446
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.