DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15695 and CG31933

DIOPT Version :10

Sequence 1:NP_650920.3 Gene:CG15695 / 42468 FlyBaseID:FBgn0038832 Length:725 Species:Drosophila melanogaster
Sequence 2:NP_722734.1 Gene:CG31933 / 326176 FlyBaseID:FBgn0051933 Length:673 Species:Drosophila melanogaster


Alignment Length:54 Identity:13/54 - (24%)
Similarity:21/54 - (38%) Gaps:11/54 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ASYPRVKPDFKSELESFRTETLAKADTQEKNCLPTAADVQSEKAQRSVIEGIEG 64
            |.:|.::....:.....|||...||:...|:|           ..|.:|:.|.|
  Fly   144 AMFPILRQVADNFAHFLRTEVDGKAELDMKDC-----------CARMMIDNIGG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15695NP_650920.3 DUF229 180..656 CDD:397236
CG31933NP_722734.1 DUF229 114..576 CDD:397236 13/54 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.