DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PRE1

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_010928.1 Gene:PRE1 / 856731 SGDID:S000000814 Length:198 Species:Saccharomyces cerevisiae

Alignment Length:215 Identity:50/216 (23%)
Similarity:83/216 (38%) Gaps:44/216 (20%)


  Fly    35 VGVRGANCVVLGVEKS-----SVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQ 94
            :|:|..:.|:|...|:     ||.:..:|:|    ..|..|..::|||...|........|...|
Yeast     5 LGIRVQDSVILASSKAVTRGISVLKDSDDKT----RQLSPHTLMSFAGEAGDTVQFAEYIQANIQ 65

  Fly    95 SHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGID-ADGSARLFHTEPSGIFHEY 158
            .:.:..:.:::.:.::.::.|...|  ....|||:.::.||||.| ......|:..:..|...|.
Yeast    66 LYSIREDYELSPQAVSSFVRQELAK--SIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVEL 128

  Fly   159 KATATGRWANTVREFFEKAYSDH----EVTTK--CDAIKLAMRALLEVTQMSQMRLEVAVLENGK 217
            ...|.|     ...|:..:..||    ::||:  .|.:||.                |..||...
Yeast   129 PYGAHG-----YSGFYTFSLLDHHYRPDMTTEEGLDLLKLC----------------VQELEKRM 172

  Fly   218 PMKMLDSVVISEIVKIVQNE 237
            ||...     ..|||||..:
Yeast   173 PMDFK-----GVIVKIVDKD 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 50/216 (23%)
proteasome_alpha_type_7 5..213 CDD:239724 41/190 (22%)
PRE1NP_010928.1 proteasome_beta_type_2 1..194 CDD:239727 50/216 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.