DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PRE5

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_014045.1 Gene:PRE5 / 855362 SGDID:S000004931 Length:234 Species:Saccharomyces cerevisiae

Alignment Length:237 Identity:73/238 (31%)
Similarity:110/238 (46%) Gaps:14/238 (6%)


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            :.|......|||.|.|.|||||.||:::||..||:|.....||...|.:..|:...:  :||...
Yeast     4 NNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQ--KKIIKC 66

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
            |.|:.|:.|||..|||:|.|..:.:|....|.|..::.:|.....|....||.||..|.||:|:.
Yeast    67 DEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVG 131

  Fly   133 CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDA-----IKL 192
            .||.|.|..| |.|...:|||...|...||.|..:...:.:.|:..   :...|.|.     ||.
Yeast   132 LLIIGYDKSG-AHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL---DTFIKIDGNPDELIKA 192

  Fly   193 AMRAL---LEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIV 231
            .:.|:   |....::...|.:|::....|..:.|...:::.:
Yeast   193 GVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 73/236 (31%)
proteasome_alpha_type_7 5..213 CDD:239724 71/216 (33%)
PRE5NP_014045.1 Ntn_hydrolase 6..217 CDD:320988 71/217 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.