DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PRE5

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_014045.1 Gene:PRE5 / 855362 SGDID:S000004931 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:73/237 - (30%)
Similarity:110/237 - (46%) Gaps:14/237 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            :.|......|||.|.|.|||||.||:::||..||:|.....||...|.:..|:...:  :||...
Yeast     4 NNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQ--KKIIKC 66

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
            |.|:.|:.|||..|||:|.|..:.:|....|.|..::.:|.....|....||.||..|.||:|:.
Yeast    67 DEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVG 131

  Fly   133 CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDA-----IKL 192
            .||.|.|..| |.|...:|||...|...||.|..:...:.:.|:..   :...|.|.     ||.
Yeast   132 LLIIGYDKSG-AHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL---DTFIKIDGNPDELIKA 192

  Fly   193 AMRAL---LEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIV 231
            .:.|:   |....::...|.:|::....|..:.|...:::.:
Yeast   193 GVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 proteasome_alpha_type_7 5..213 CDD:239724 71/215 (33%)
PRE5NP_014045.1 Ntn_hydrolase 6..217 CDD:469781 71/216 (33%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.