DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PAD2

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_201415.1 Gene:PAD2 / 836746 AraportID:AT5G66140 Length:250 Species:Arabidopsis thaliana

Alignment Length:248 Identity:133/249 (53%)
Similarity:171/249 (69%) Gaps:9/249 (4%)


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            :||.||:|:|||||||.|||||.||||||:.||||||.:.|||.|||.|..::|:.|:.|||..|
plant     2 ARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSL 66

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
            |.|:|||.|||.||||:|||:.::|||||||..|:.||:||||||:|.|:|||||..|.||||:|
plant    67 DNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLS 131

  Fly   133 CLIGGIDA-DGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRA 196
            .||.|.|. .....|:.|:|||.|..:||.||||.:|::|||.||.|.:   ::..:.||||:||
plant   132 TLIVGFDPYSRLPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKE---SSGQETIKLAIRA 193

  Fly   197 LLEVTQMSQMRLEVAVL---ENGKPMKMLDSVVISEIVKIVQNEKELQAKAHK 246
            ||||.:.....:||||:   |.|  ::.|:...|..||..::.||.....|.|
plant   194 LLEVVESGGKNIEVAVMTREETG--LRQLEEAEIDAIVAKIEAEKAAAEAAKK 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 130/238 (55%)
proteasome_alpha_type_7 5..213 CDD:239724 122/209 (58%)
PAD2NP_201415.1 PRK03996 1..229 CDD:235192 128/232 (55%)
proteasome_alpha_type_7 4..210 CDD:239724 122/209 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2086
Inparanoid 1 1.050 270 1.000 Inparanoid score I899
OMA 1 1.010
OrthoDB 1 1.010 D1222564at2759
OrthoInspector 1 1.000 T32345
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11599
Phylome 1 0.910 0.800 Consistency score
88.080

Return to query results.
Submit another query.