DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PAF1

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_199093.1 Gene:PAF1 / 834290 AraportID:AT5G42790 Length:278 Species:Arabidopsis thaliana

Alignment Length:248 Identity:83/249 (33%)
Similarity:137/249 (55%) Gaps:9/249 (4%)


  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67
            ::|...:|.:||.|.|.|||||.|||::||.|:|:|..:.|||.....:.||:...:  |||..:
plant     4 NQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ--RKIFKV 66

  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132
            |.|:.:|.||||||.|:|....:.|..:|...:|:.:.:..:..:||...|..||.:.:||:|:.
plant    67 DDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGVG 131

  Fly   133 CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIK---LAM 194
            .|:||:|..| |.|::..|||.:.||:|.|.|..:...:.:.|:.:.....:::.|.||   ||:
plant   132 LLVGGLDESG-AHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESFGDSSREDLIKDAILAV 195

  Fly   195 RALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIV---KIVQNEKELQAKA 244
            |..|:...:......||:|...:|...||...|.:::   :.|..|:|.:.:|
plant   196 RETLQGETLKSSLCTVAILGVDEPFHFLDQEAIQKVIDTFEKVPEEEEGEGEA 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 81/240 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 74/211 (35%)
PAF1NP_199093.1 PRE1 4..237 CDD:223711 79/236 (33%)
proteasome_alpha_type_1 6..215 CDD:239718 75/212 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.