DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PAC1

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_188850.1 Gene:PAC1 / 821774 AraportID:AT3G22110 Length:250 Species:Arabidopsis thaliana


Alignment Length:215 Identity:78/215 - (36%)
Similarity:122/215 - (56%) Gaps:6/215 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSE-MQEDRTVRKI 64
            ||.||....|||||:|.|.|||||.||:....:|:|:...:.|||..||...|: :|...:..|:
plant     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKM 65

  Fly    65 SMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPF 129
            ..:|.|||.|.||:.:||.||||..:|:.|.:...::..:.:|.:.:.|...||.|||..|.|||
plant    66 YKIDDHVACAVAGIMSDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPF 130

  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAM 194
            |:|.|..|.|.....:|:.::|||.:..:||.|.|......:...::.|.|.  .|:.:|::||:
plant   131 GVSFLFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANNQAAQSILKQDYKDD--ATREEAVELAL 193

  Fly   195 RAL---LEVTQMSQMRLEVA 211
            :.|   ::.|.::..:||:|
plant   194 KVLTKTMDSTSLTSEKLELA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 75/211 (36%)
proteasome_alpha_type_7 5..213 CDD:239724 75/211 (36%)
PAC1NP_188850.1 proteasome_alpha_type_4 3..215 CDD:239721 76/213 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.