DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PAC1

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_188850.1 Gene:PAC1 / 821774 AraportID:AT3G22110 Length:250 Species:Arabidopsis thaliana

Alignment Length:215 Identity:78/216 (36%)
Similarity:122/216 (56%) Gaps:6/216 (3%)


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSE-MQEDRTVRKI 64
            ||.||....|||||:|.|.|||||.||:....:|:|:...:.|||..||...|: :|...:..|:
plant     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKM 65

  Fly    65 SMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPF 129
            ..:|.|||.|.||:.:||.||||..:|:.|.:...::..:.:|.:.:.|...||.|||..|.|||
plant    66 YKIDDHVACAVAGIMSDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPF 130

  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAM 194
            |:|.|..|.|.....:|:.::|||.:..:||.|.|......:...::.|.|.  .|:.:|::||:
plant   131 GVSFLFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANNQAAQSILKQDYKDD--ATREEAVELAL 193

  Fly   195 RAL---LEVTQMSQMRLEVA 211
            :.|   ::.|.::..:||:|
plant   194 KVLTKTMDSTSLTSEKLELA 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 75/212 (35%)
proteasome_alpha_type_7 5..213 CDD:239724 75/212 (35%)
PAC1NP_188850.1 proteasome_alpha_type_4 3..215 CDD:239721 76/214 (36%)
PRK03996 5..237 CDD:235192 75/212 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.