DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psmb11

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_780413.1 Gene:Psmb11 / 73902 MGIID:1921152 Length:302 Species:Mus musculus

Alignment Length:225 Identity:51/226 (23%)
Similarity:91/226 (40%) Gaps:22/226 (10%)


  Fly    31 GSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADA----RILINRGQ 90
            |:|.:..|..:.|:...: :||..........||:..:.:.:....:|.:||.    |:|  |.:
Mouse    49 GTTTLAFRFRHGVIAAADTRSSCGSYVACPASRKVIPVHQRLLGTTSGTSADCATWYRVL--RRE 111

  Fly    91 VECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADGSARLFHTEPSGIF 155
            :..:..|   |.|:.....|   |:|......|.......::..:.|.|..|.| ||:....|..
Mouse   112 LRLRELR---EGQLPSVAGT---AKLLAAMMSCYRGLDLCVATALCGWDHSGPA-LFYVYSDGTC 169

  Fly   156 HEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRALLEVTQ---MSQMRLEV-AVLENG 216
            .:....:.|..:.......::.|  |...|..:|..||..|:...|.   .|...::: .|.|:|
Mouse   170 LQGDIFSVGSGSPYAYGVLDRGY--HYDMTIQEAYTLARCAVAHATHRDAYSGGSVDLFHVRESG 232

  Fly   217 -KPMKMLDSVVI-SEIVKIVQNEKELQAKA 244
             :.:...|:.|: .|:.|....|:||:|||
Mouse   233 WEYVSRSDACVLYRELQKARSLEQELEAKA 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 46/219 (21%)
proteasome_alpha_type_7 5..213 CDD:239724 39/191 (20%)
Psmb11NP_780413.1 20S_bact_beta 48..253 CDD:163402 45/215 (21%)
proteasome_beta_type_5 50..237 CDD:239730 40/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.