DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psmb3

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001123295.1 Gene:psmb3 / 573095 ZFINID:ZDB-GENE-040426-2682 Length:205 Species:Danio rerio


Alignment Length:120 Identity:28/120 - (23%)
Similarity:47/120 - (39%) Gaps:25/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTAVGVRGANCVVLGVEKSSVSEMQEDRT-VRKISMLDRHVALAFAGLTADARILINRGQVECQ 94
            |...:.:||..||.:..::....:.|...| .:||..:...:.:..|||..|         |:..
Zfish     8 GGAVMAMRGKECVAIASDRRFGIQAQLVTTDFQKIFPMGERLYIGLAGLATD---------VQTV 63

  Fly    95 SHRLNFENQVTLEYITRYLAQLKQK----------YTQCNGRRPFGISCLIGGID 139
            |.||.|...:   |..:...|:|.:          |.:..|  |:.|..:|.|:|
Zfish    64 SQRLKFRLNL---YELKEGRQIKPRTFMSMVSNLLYERRFG--PYYIEPVIAGLD 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 28/120 (23%)
proteasome_alpha_type_7 5..213 CDD:239724 28/120 (23%)
psmb3NP_001123295.1 PRE1 3..198 CDD:223711 28/120 (23%)
proteasome_beta_type_3 6..201 CDD:239728 28/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.