DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PSMB10

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_002792.1 Gene:PSMB10 / 5699 HGNCID:9538 Length:273 Species:Homo sapiens

Alignment Length:147 Identity:36/148 (24%)
Similarity:69/148 (47%) Gaps:10/148 (7%)


  Fly    19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSE-MQEDRTVRKISMLDRHVALAFAGLTADA 82
            |:|.:|:   :.|:|..|:...:.|:||.:..:.:: :..|::..||..:...:....||:.|||
Human    30 LKVPHAR---KTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADA 91

  Fly    83 RILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADGSARLF 147
            .:.......:.:.|.|:...:..:..:||.|.|...:|     :...|.|.::||:|..| .:|:
Human    92 EMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRY-----QGHVGASLIVGGVDLTG-PQLY 150

  Fly   148 HTEPSGIFHEYKATATG 164
            ...|.|.:.....||.|
Human   151 GVHPHGSYSRLPFTALG 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 36/148 (24%)
proteasome_alpha_type_7 5..213 CDD:239724 36/148 (24%)
PSMB10NP_002792.1 proteasome_beta_type_7 40..227 CDD:239732 32/135 (24%)
Pr_beta_C 233..267 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.