DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PSMB8

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_683720.2 Gene:PSMB8 / 5696 HGNCID:9545 Length:276 Species:Homo sapiens

Alignment Length:203 Identity:41/204 (20%)
Similarity:76/204 (37%) Gaps:51/204 (25%)


  Fly    19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADA 82
            :|:|.|.     |:|.:..:..:.|:..|: ::|.........|.|:..::.::....:|..||.
Human    65 VQIEMAH-----GTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADC 124

  Fly    83 ----RILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS--CLIGGIDAD 141
                |:|..    ||:.:.|....::::...::.|:.:..:|      |..|:|  .:|.|.|..
Human   125 QYWERLLAK----ECRLYYLRNGERISVSAASKLLSNMMCQY------RGMGLSMGSMICGWDKK 179

  Fly   142 G-------------SARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLA 193
            |             |..:|.| .||..:.|....:|...|...|               :|..|.
Human   180 GPGLYYVDEHGTRLSGNMFST-GSGNTYAYGVMDSGYRPNLSPE---------------EAYDLG 228

  Fly   194 MRALLEVT 201
            .||:...|
Human   229 RRAIAYAT 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 41/204 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 41/204 (20%)
PSMB8NP_683720.2 PTZ00488 39..271 CDD:185666 41/204 (20%)
proteasome_beta_type_5 73..260 CDD:239730 37/191 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.