| Sequence 1: | NP_650910.1 | Gene: | Prosalpha4T1 / 42457 | FlyBaseID: | FBgn0265606 | Length: | 249 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_683720.2 | Gene: | PSMB8 / 5696 | HGNCID: | 9545 | Length: | 276 | Species: | Homo sapiens |
| Alignment Length: | 203 | Identity: | 41/203 - (20%) |
|---|---|---|---|
| Similarity: | 76/203 - (37%) | Gaps: | 51/203 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADA 82
Fly 83 ----RILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS--CLIGGIDAD 141
Fly 142 G-------------SARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLA 193
Fly 194 MRALLEVT 201 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Prosalpha4T1 | NP_650910.1 | PRK03996 | 5..239 | CDD:235192 | 41/203 (20%) |
| proteasome_alpha_type_7 | 5..213 | CDD:239724 | 41/203 (20%) | ||
| PSMB8 | NP_683720.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | ||
| proteasome_beta_type_5 | 73..260 | CDD:239730 | 37/190 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||