DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and PSMB8

DIOPT Version :10

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_683720.2 Gene:PSMB8 / 5696 HGNCID:9545 Length:276 Species:Homo sapiens


Alignment Length:203 Identity:41/203 - (20%)
Similarity:76/203 - (37%) Gaps:51/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADA 82
            :|:|.|.     |:|.:..:..:.|:..|: ::|.........|.|:..::.::....:|..||.
Human    65 VQIEMAH-----GTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADC 124

  Fly    83 ----RILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS--CLIGGIDAD 141
                |:|..    ||:.:.|....::::...::.|:.:..:|      |..|:|  .:|.|.|..
Human   125 QYWERLLAK----ECRLYYLRNGERISVSAASKLLSNMMCQY------RGMGLSMGSMICGWDKK 179

  Fly   142 G-------------SARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLA 193
            |             |..:|.| .||..:.|....:|...|...|               :|..|.
Human   180 GPGLYYVDEHGTRLSGNMFST-GSGNTYAYGVMDSGYRPNLSPE---------------EAYDLG 228

  Fly   194 MRALLEVT 201
            .||:...|
Human   229 RRAIAYAT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 proteasome_alpha_type_7 5..213 CDD:239724 41/203 (20%)
PSMB8NP_683720.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
proteasome_beta_type_5 73..260 CDD:239730 37/190 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.