DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psmb3

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001016503.1 Gene:psmb3 / 549257 XenbaseID:XB-GENE-1008325 Length:205 Species:Xenopus tropicalis

Alignment Length:112 Identity:24/113 (21%)
Similarity:45/113 (40%) Gaps:9/113 (8%)


  Fly    31 GSTAVGVRGANCVVLGVEKS-SVSEMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQ 94
            |...:.:||.:||.:..::. .|.........:||..:...:.:..|||..|.:.:..|.:....
 Frog     8 GGAIMAMRGKDCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVSQRLKFRLN 72

  Fly    95 SHRLNFENQVTLEYITRYLAQLKQKYTQCNGRR--PFGISCLIGGID 139
            .:.|....|:..:.....:|.|..:      ||  |:.|..:|.|:|
 Frog    73 LYELKEGRQIKPKTFMSMVANLLYE------RRFGPYYIEPVIAGLD 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 24/113 (21%)
proteasome_alpha_type_7 5..213 CDD:239724 24/113 (21%)
psmb3NP_001016503.1 PRE1 3..198 CDD:223711 24/113 (21%)
proteasome_beta_type_3 6..201 CDD:239728 24/113 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.