DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psma4

DIOPT Version :9

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001007998.1 Gene:psma4 / 493360 XenbaseID:XB-GENE-5837209 Length:261 Species:Xenopus tropicalis


Alignment Length:256 Identity:83/256 - (32%)
Similarity:146/256 - (57%) Gaps:11/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTV-RKI 64
            ||.||....|||||:|.|.|||||.||:....|.:|:...:.|:|..|:.::.::.::... .||
 Frog     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKI 65

  Fly    65 SMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPF 129
            ..|:..:|.:.||:|:||.:|.|..::..|.:.|.::..:..|.:...|..:||.|||..|:|||
 Frog    66 YKLNDDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPF 130

  Fly   130 GISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAM 194
            |:|.|..|.|.....:|:.::|||.:..:|||..|..:.......::.|.:.::|.| .|:.||:
 Frog   131 GVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGDMTLK-SALALAV 194

  Fly   195 RAL---LEVTQMSQMRLEVAVL--ENGK-PMKMLDSVVISEIVKIVQNEKELQAKAHKMKR 249
            :.|   ::|:::|..::|:|.|  |||| .:::|....:.|::|:.:.|   :||..:.|:
 Frog   195 KVLNKTMDVSKLSAEKVEIATLTRENGKTKIRVLKQKEVEELIKLHEEE---EAKIEREKK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 77/240 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 68/211 (32%)
psma4NP_001007998.1 proteasome_alpha_type_4 3..216 CDD:239721 69/213 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.