DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Prosbeta1

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster

Alignment Length:171 Identity:33/172 (19%)
Similarity:66/172 (38%) Gaps:14/172 (8%)


  Fly    22 EYAQEAVRKGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTVRKISMLDRHVALAFAGLTADARIL 85
            ::....|..|:|.:.|.....||:|.: ::|......:|...|::.:...|....:|..||.:.:
  Fly     6 DFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAI 70

  Fly    86 INRGQVECQSHRLNF-ENQVTLEYITRYLAQLKQKYTQCNGRRP---FGISCLIGGIDADGSARL 146
                 .:..::.||: |||...:.:....|...:.|  |...|.   .||  ::.|.|.....::
  Fly    71 -----ADIVAYSLNYHENQTNKDALVFEAASEFRNY--CYSYRESLLAGI--IVAGWDEQRGGQV 126

  Fly   147 FHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKC 187
            :.....|:......|..|..::.:..|..:.|..:.....|
  Fly   127 YSIPLGGMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDC 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 33/172 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 33/172 (19%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 32/163 (20%)
proteasome_beta_type_6 16..203 CDD:239731 31/162 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79725996
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.