DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psmb8

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_012809693.1 Gene:psmb8 / 445258 XenbaseID:XB-GENE-479064 Length:281 Species:Xenopus tropicalis

Alignment Length:217 Identity:41/218 (19%)
Similarity:90/218 (41%) Gaps:39/218 (18%)


  Fly     5 YGRALTI---FSPDGHLLQVEYAQEAVR----KGSTAVGVRGANCVVLGVE-KSSVSEMQEDRTV 61
            |...|.:   :.|...|..:|...:.|:    .|:|.:..:..:.|::.|: ::|......:...
 Frog    33 YNTELAVPPGYQPAKFLEHLEEGVDDVKIEPWHGTTTLAFKFQHGVIVAVDSRASAGSYISNVKF 97

  Fly    62 RKISMLDRHVALAFAGLTADA----RILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQ 122
            .|:..::.::....:|..||.    |:|..    ||:.::|...:::::...::.:..:..:|  
 Frog    98 NKVIEINPYLLGTMSGSAADCQYWERVLAK----ECRLYQLRNNSRISVSAASKLMCNMMLQY-- 156

  Fly   123 CNGRRPFGIS--CLIGGIDADGSARLFHTEPSG------IFHEYKATATGRWANTVREFFEKAYS 179
                |..|:|  .:|.|.|..|.. |::...:|      ||      :||...:......:..|.
 Frog   157 ----RGTGLSVGSMICGWDKKGPG-LYYVNDNGTRLCGDIF------STGSGNSYAYGVMDSGYR 210

  Fly   180 DHEVTTKCDAIKLAMRALLEVT 201
             :::|.: :|..|..||:...|
 Frog   211 -YDLTPE-EAYDLGRRAISYAT 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 41/218 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 41/218 (19%)
psmb8XP_012809693.1 PTZ00488 40..269 CDD:185666 39/211 (18%)
proteasome_beta_type_5 67..254 CDD:239730 34/184 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.