DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psmb10

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio

Alignment Length:166 Identity:43/167 (26%)
Similarity:74/167 (44%) Gaps:8/167 (5%)


  Fly    15 DGHLLQVEYAQEAVRK-GSTAVGVRGANCVVLGVEKSSVSEM-QEDRTVRKISMLDRHVALAFAG 77
            :.:|.:..|:....|| |:|..|:...:.|:||.:..:..:| ..|:...||..:..::....||
Zfish    25 EANLSEKGYSAPNARKTGTTIAGLVFKDGVILGADTRATDDMVVADKNCMKIHYIAPNIYCCGAG 89

  Fly    78 LTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGIDADG 142
            :.|||.:.........:.|.|:......:..:||   ||||...:..|.  .|.|.::||:|.:|
Zfish    90 VAADAEVTTQMMSSNVELHSLSTGRPPLVAMVTR---QLKQMLFRYQGH--IGSSLIVGGVDVNG 149

  Fly   143 SARLFHTEPSGIFHEYKATATGRWANTVREFFEKAY 178
             |:|:...|.|.:.:......|..|.:....||..|
Zfish   150 -AQLYSVYPHGSYDKLPFLTMGSGAASAISVFEDRY 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 43/167 (26%)
proteasome_alpha_type_7 5..213 CDD:239724 43/167 (26%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 40/152 (26%)
proteasome_beta_type_7 43..231 CDD:239732 38/149 (26%)
Pr_beta_C 237..270 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.