| Sequence 1: | NP_650910.1 | Gene: | Prosalpha4T1 / 42457 | FlyBaseID: | FBgn0265606 | Length: | 249 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_651843.1 | Gene: | Prosalpha3T / 43679 | FlyBaseID: | FBgn0261395 | Length: | 251 | Species: | Drosophila melanogaster | 
| Alignment Length: | 248 | Identity: | 77/248 - (31%) | 
|---|---|---|---|
| Similarity: | 123/248 - (49%) | Gaps: | 5/248 - (2%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKIS 65 
  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130 
  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTV-----REFFEKAYSDHEVTTKCDAI 190 
  Fly   191 KLAMRALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAK 243  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Prosalpha4T1 | NP_650910.1 | PRK03996 | 5..239 | CDD:235192 | 75/238 (32%) | 
| proteasome_alpha_type_7 | 5..213 | CDD:239724 | 73/212 (34%) | ||
| Prosalpha3T | NP_651843.1 | PTZ00246 | 1..241 | CDD:173491 | 76/239 (32%) | 
| Ntn_hydrolase | 3..218 | CDD:294319 | 73/214 (34%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45441093 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1222564at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11599 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.850 | |||||