DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Prosbeta3

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_649858.1 Gene:Prosbeta3 / 41079 FlyBaseID:FBgn0026380 Length:205 Species:Drosophila melanogaster

Alignment Length:120 Identity:21/121 (17%)
Similarity:46/121 (38%) Gaps:25/121 (21%)


  Fly    31 GSTAVGVRGANCVVL------GVEKSSVSEMQEDRTVRKISMLDRHVALAFAGLTADA-----RI 84
            |...|.:||.:||.:      |::..::|     ...:|:..:...:.|...||..|.     |:
  Fly     8 GGCVVAMRGKDCVAIATDHRFGIQAQTIS-----TDFKKVFHIGPRMFLGLTGLQTDILTVRDRL 67

  Fly    85 LINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGISCLIGGID 139
            :..:...|.:.:|         |...:..:.:...:...:...|:.|..::.|:|
  Fly    68 MFRKNLYETRENR---------EMCPKPFSAMMSSFLYEHRFGPYFIEPVVAGLD 113

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 21/121 (17%)
proteasome_alpha_type_7 5..213 CDD:239724 21/121 (17%)
Prosbeta3NP_649858.1 proteasome_beta_type_3 6..201 CDD:239728 21/121 (17%)
PRE1 6..198 CDD:223711 21/121 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79723401
eggNOG 1 0.900 E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.