DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and psma8

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_998331.1 Gene:psma8 / 406445 ZFINID:ZDB-GENE-040426-2194 Length:251 Species:Danio rerio

Alignment Length:249 Identity:154/250 (62%)
Similarity:195/250 (78%) Gaps:0/250 (0%)


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKIS 65
            |::||.||:|:|||||||.|||||||||:|||||||:||.:.|||||||.||:::||:||||||.
Zfish     1 MAARYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGKDIVVLGVEKKSVAKLQEERTVRKIC 65

  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130
            .||.||.:|||||||||||:|||.:||||||||..|:.||:||||||:|.|||:|||.|||||||
Zfish    66 ALDEHVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNGRRPFG 130

  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMR 195
            ||.||.|.|.||:.||:.|:|||.:|.:||.|.||.|.|||||.||.|:|..:.:..||||||::
Zfish   131 ISALIVGFDYDGTPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTDEAIASDNDAIKLAIK 195

  Fly   196 ALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAKAHKMKR 249
            |||||.|.....:|:||:...:|:|:|:|..|..:|..::.|||.:|:..|.|:
Zfish   196 ALLEVVQSGGKNIELAVIRRNQPLKILESKEIETLVAEIEKEKEEEAEKKKQKK 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 148/234 (63%)
proteasome_alpha_type_7 5..213 CDD:239724 140/208 (67%)
psma8NP_998331.1 proteasome_alpha_type_7 5..213 CDD:239724 140/208 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 1 1.000
Homologene 1 1.000 H2086
Inparanoid 1 1.050 358 1.000 Inparanoid score I2147
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 1 1.000 FOG0001835
OrthoInspector 1 1.000 T596401
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11599
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.