DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Prosbeta7

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster

Alignment Length:245 Identity:53/246 (22%)
Similarity:108/246 (44%) Gaps:34/246 (14%)


  Fly     7 RALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEK-SSVSEMQEDRTVRKISMLDRH 70
            |.||...|.|    .:::..:...|::.:|:|..:.|:|..:. .|...|...:.:.::..::::
  Fly    37 RELTTMGPYG----TKHSTASSTTGTSVLGIRYDSGVMLAADTLVSYGSMARYQNIERVFKVNKN 97

  Fly    71 VALAFAGLTADARIL---INRGQVE--CQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130
            :.|..:|..||.:.:   |::..:|  |....:..:.:....::||.|      |.:.:...|..
  Fly    98 ILLGGSGDFADIQSIKRNIDQKMIEDQCCDDNIEMKPKSLASWMTRVL------YNRRSRMNPLY 156

  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWAN-----TVREFFEKAYSDHEVTT--KCD 188
            |..::||:|.:|:..|.:.:..|..:|....||| :|.     .||   ||...|.:.|.  ..:
  Fly   157 IDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATG-FARHLAVPLVR---EKKPKDRDFTAVEASE 217

  Fly   189 AIKLAMRALL--EVTQMSQMRLEVAVLENG----KPMKMLDSVVISEIVK 232
            .|:..|..|.  :...:||..:.|..: ||    .|.::.::...:|.:|
  Fly   218 LIRTCMEVLYYRDTRNISQYTVGVCSV-NGCGVEGPFQVNENWTFAETIK 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 53/246 (22%)
proteasome_alpha_type_7 5..213 CDD:239724 48/221 (22%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 44/203 (22%)
PRE1 60..232 CDD:223711 39/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79517903
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.