DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Prosbeta5R1

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster

Alignment Length:182 Identity:41/183 (22%)
Similarity:78/183 (43%) Gaps:28/183 (15%)


  Fly    31 GSTAVGVRGANCVVLGVEKSSVS-EMQEDRTVRKISMLDRHVALAFAGLTADA----RILINRGQ 90
            |:|.:|.:....|:|..:..:.| :....:|:|||..|:.::....||..||.    |:|..   
  Fly    71 GTTTLGFKYRGGVILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAK--- 132

  Fly    91 VECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGI--SCLIGGIDADGSARLFHTEPSG 153
             ||:.|:|.:..::|::...|.:..:..:|      :..|:  ..::.|.|.:| .:|.:.:..|
  Fly   133 -ECRLHQLRYRKRMTVDTAARIICNISTEY------KGMGLVMGMMLAGFDDEG-PKLIYVDSEG 189

  Fly   154 IFHEYKATATGRWANTVREFFEKAY----SDHEVTTKCDAIKLAMRALLEVT 201
            :....:..:.|..:.......:..|    ||.|      |..||.||:...|
  Fly   190 MRSHGQVFSVGSGSPYALGVLDTGYRYDLSDQE------AYDLARRAIYHAT 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 41/183 (22%)
proteasome_alpha_type_7 5..213 CDD:239724 41/183 (22%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 41/183 (22%)
proteasome_beta_type_5 72..259 CDD:239730 40/182 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C79264645
eggNOG 1 0.900 E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11599
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.