DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4T1 and Psma8

DIOPT Version :8

Sequence 1:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus

Alignment Length:249 Identity:147/250 (59%)
Similarity:191/250 (76%) Gaps:1/250 (0%)


  Fly     1 MSSRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKIS 65
            |:|||.||:|:|||||||.|||||||||:|||||||:||.|.|||||||.||:::|::||||||.
  Rat     1 MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKIC 65

  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130
            .||.||.:||||||||||::|:|.:||||||:|..|:.||:|||||::|.|||||||.|||||||
  Rat    66 ALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFG 130

  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMR 195
            ||.||.|.|.||..||:.|:|||.:|.:||.|.||.|.|||||.||.|::..::...:|||||::
  Rat   131 ISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDNEAIKLAIK 195

  Fly   196 ALLEVTQMSQMRLEVAVLENGKPMKMLDSVVISEIVKIVQNEKELQAKAHKMKR 249
            |||||.|.....:|:|::...:|:||..:..|...|..::.||: :|:..|.|:
  Rat   196 ALLEVVQSGGKNIELAIIRRDQPLKMFSAKEIELEVTEIEREKD-EAEKKKSKK 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 141/234 (60%)
proteasome_alpha_type_7 5..213 CDD:239724 134/208 (64%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 139/229 (61%)
proteasome_alpha_type_7 5..213 CDD:239724 134/208 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 1 1.000
Homologene 1 1.000 H2086
Inparanoid 1 1.050 346 1.000 Inparanoid score I2213
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 1 1.000 FOG0001835
OrthoInspector 1 1.000 T131161
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11599
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.